Lineage for d3emya_ (3emy A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2061036Family b.50.1.0: automated matches [191552] (1 protein)
    not a true family
  6. 2061037Protein automated matches [190954] (10 species)
    not a true protein
  7. 2061085Species Hypocrea jecorina [TaxId:51453] [188627] (1 PDB entry)
  8. 2061086Domain d3emya_: 3emy A: [175093]
    automated match to d1e5oe_

Details for d3emya_

PDB Entry: 3emy (more details), 1.85 Å

PDB Description: Crystal structure of Trichoderma reesei aspartic proteinase complexed with pepstatin A
PDB Compounds: (A:) Trichoderma reesei Aspartic protease

SCOPe Domain Sequences for d3emya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3emya_ b.50.1.0 (A:) automated matches {Hypocrea jecorina [TaxId: 51453]}
etgsapnhpsdsadseyitsvsigtpaqvlpldfdtgssdlwvfssetpkssatghaiyt
psksstskkvsgaswsisygdgssssgdvytdkvtiggfsvntqgvesatrvstefvqdt
visglvglafdsgnqvrphpqktwfsnaasslaeplftadlrhgqngsynfgyidtsvak
gpvaytpvdnsqgfweftasgysvgggklnrnsidgiadtgttllllddnvvdayyanvq
saqydnqqegvvfdcdedlpsfsfgvgsstitipgdllnltpleegsstcfgglqsssgi
ginifgdvalkaalvvfdlgnerlgwaqk

SCOPe Domain Coordinates for d3emya_:

Click to download the PDB-style file with coordinates for d3emya_.
(The format of our PDB-style files is described here.)

Timeline for d3emya_: