Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
Protein automated matches [190142] (21 species) not a true protein |
Species Plasmodium vivax [TaxId:5855] [188970] (1 PDB entry) |
Domain d3emva1: 3emv A:1-245 [175092] Other proteins in same PDB: d3emva2 automated match to d1nw4a_ complexed with so4 |
PDB Entry: 3emv (more details), 1.85 Å
SCOPe Domain Sequences for d3emva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3emva1 c.56.2.1 (A:1-245) automated matches {Plasmodium vivax [TaxId: 5855]} megemqrhikltkaqttpvvlvvgdpgrvdkvkvlcdsyvdlaynreyksvectykgqkf lcvshgvgsagcaicfeelmnngakviiragscgslqptqmkrgdicicnaavredrvsh lmiysdfpavadyevyatlnqvaeelkvpvfngislssdmyyphkiiptrledyskanva vvemevatlmvmgtlrkvktggifivdgcplkwdegdfdnnlvperlenmikisletcar lakky
Timeline for d3emva1: