Lineage for d3emta_ (3emt A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2518280Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2518281Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 protein domains)
  6. 2518531Protein automated matches [190032] (18 species)
    not a true protein
  7. 2518532Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries)
  8. 2518539Domain d3emta_: 3emt A: [175090]
    Other proteins in same PDB: d3emtb2
    automated match to d2b8pa1
    complexed with dgi, mg; mutant

Details for d3emta_

PDB Entry: 3emt (more details), 1.6 Å

PDB Description: Crystal structure of the mimivirus NDK +Kpn-R107G double mutant complexed with dGDP
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3emta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3emta_ d.58.6.1 (A:) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
ncdfmvsgpiisivyegtdaiskirrlqgntnplasapgtirgdlandigenlihasdse
dsavdeisiwfpe

SCOPe Domain Coordinates for d3emta_:

Click to download the PDB-style file with coordinates for d3emta_.
(The format of our PDB-style files is described here.)

Timeline for d3emta_: