Lineage for d3emkd_ (3emk D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1830816Species Brucella melitensis [TaxId:29459] [188645] (2 PDB entries)
  8. 1830824Domain d3emkd_: 3emk D: [175088]
    automated match to d1q7ba_

Details for d3emkd_

PDB Entry: 3emk (more details), 2.5 Å

PDB Description: 2.5a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis
PDB Compounds: (D:) glucose/ribitol dehydrogenase

SCOPe Domain Sequences for d3emkd_:

Sequence, based on SEQRES records: (download)

>d3emkd_ c.2.1.0 (D:) automated matches {Brucella melitensis [TaxId: 29459]}
smfdltgrkalvtgatgglgeaiaralhaqgaivglhgtreeklkelaaelgerifvfpa
nlsdreavkalgqkaeeemggvdilvnnagitrdglfvrmsdedwdavltvnltsvfnlt
relthpmmrrrngriinitsivgvtgnpgqanycaskagligfskslaqeiasrnvtvnc
iapgfiesamtgklnekqkdaimgnipmkrmgvgadiaaavvylasdeaayvtgqtlhvn
ggmami

Sequence, based on observed residues (ATOM records): (download)

>d3emkd_ c.2.1.0 (D:) automated matches {Brucella melitensis [TaxId: 29459]}
smfdltgrkalvtgatgglgeaiaralhaqgaivglhgtreeklkelaaelgerifvfpa
nlsdreavkalgqkaeeemggvdilvnnagitrdglfvrmsdedwdavltvnltsvfnlt
relthpmmrrrngriinitsivgvtgnpgqanycaskagligfskslaqeiasrnvtvnc
iapgfieekqkdaimgnipmkrmgvgadiaaavvylasdeaayvtgqtlhvnggmami

SCOPe Domain Coordinates for d3emkd_:

Click to download the PDB-style file with coordinates for d3emkd_.
(The format of our PDB-style files is described here.)

Timeline for d3emkd_: