SCOPe 2.01: Domain d3em6b_: 3em6 B:

Lineage for d3em6b_ (3em6 B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein automated matches [190433] (10 species)
   not a true protein

7. Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [188968] (6 PDB entries)

8. Domain d3em6b_: 3em6 B: [175084]
   automated match to d1kzka_
   complexed with 017, act, po4; mutant

Details for d3em6b_

PDB Entry: 3em6, 2.1 Å

PDB Description: crystal structure of i50l/a71v mutant of hiv-1 protease in complex with inhibitor darunavir

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d3em6b_:

Sequence; same for both SEQRES and ATOM records:

>d3em6b_ b.50.1.1 (B:) automated matches {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmigglggfikvrqyd
qipveicghkvigtvlvgptpvniigrnlltqigctlnf

Timeline for d3em6b_:

• d3em6b_ is new in SCOPe 2.01-stable
  
• d3em6b_ appears in SCOPe 2.02
  
• d3em6b_ appears in the current release, SCOPe 2.08