Lineage for d3em4a_ (3em4 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2391027Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2392314Protein automated matches [190433] (11 species)
    not a true protein
  7. 2392322Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [188968] (6 PDB entries)
  8. 2392329Domain d3em4a_: 3em4 A: [175075]
    automated match to d1kzka_
    complexed with dr7, po4

Details for d3em4a_

PDB Entry: 3em4 (more details), 2.1 Å

PDB Description: crystal structure of atazanavir (atv) in complex with i50l/a71v drug- resistant hiv-1 protease
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3em4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3em4a_ b.50.1.1 (A:) automated matches {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmigglggfikvrqyd
qipveicghkvigtvlvgptpvniigrnlltqigctlnf

SCOPe Domain Coordinates for d3em4a_:

Click to download the PDB-style file with coordinates for d3em4a_.
(The format of our PDB-style files is described here.)

Timeline for d3em4a_: