SCOPe 2.08: Domain d3em3a_: 3em3 A:

Lineage for d3em3a_ (3em3 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein automated matches [190433] (12 species)
   not a true protein

7. Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [188968] (6 PDB entries)

8. Domain d3em3a_: 3em3 A: [175073]
   automated match to d1kzka_
   complexed with 478, act

Details for d3em3a_

PDB Entry: 3em3, 2.2 Å

PDB Description: crystal structure of amprenavir (apv) in complex with a drug resistant hiv-1 protease variant (i50l/a71v).

PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3em3a_:

Sequence; same for both SEQRES and ATOM records:

>d3em3a_ b.50.1.1 (A:) automated matches {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmigglggfikvrqyd
qipieicghkvigtvlvgptpvniigrnlltqigctlnf

Timeline for d3em3a_:

• d3em3a_ first appeared in SCOPe 2.01
  
• d3em3a_ appears in SCOPe 2.07