![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
![]() | Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
![]() | Protein automated matches [190032] (18 species) not a true protein |
![]() | Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries) |
![]() | Domain d3em1b1: 3em1 B:2-133 [175072] Other proteins in same PDB: d3em1a2, d3em1b2 automated match to d2b8pa1 complexed with mg, tyd; mutant |
PDB Entry: 3em1 (more details), 1.5 Å
SCOPe Domain Sequences for d3em1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3em1b1 d.58.6.1 (B:2-133) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]} qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd lcdfmvsgpiisivyegtdaiskirrlqgntnplasapgtirgdlandirenlihasdse dsavdeisiwfp
Timeline for d3em1b1: