Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.0: automated matches [191454] (1 protein) not a true family |
Protein automated matches [190698] (25 species) not a true protein |
Species Zebrafish (Danio rerio) [TaxId:7955] [188731] (3 PDB entries) |
Domain d3elzb1: 3elz B:1-130 [175067] Other proteins in same PDB: d3elza2, d3elzb2, d3elzb3, d3elzc2, d3elzc3 automated match to d1o1ua_ complexed with chd |
PDB Entry: 3elz (more details), 2.2 Å
SCOPe Domain Sequences for d3elzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3elzb1 b.60.1.0 (B:1-130) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} afngkwetesqegyepfckligipddviakgrdfklvteivqngddftwtqyypnnhvvt nkfivgkesdmetvggkkfkgivsmeggkltisfpkyqqtteisggklvetstasgaqgt avlvrtskkv
Timeline for d3elzb1: