SCOPe 2.05: Domain d3elxa_: 3elx A:

Lineage for d3elxa_ (3elx A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.0: automated matches [191454] (1 protein)
   not a true family

6. Protein automated matches [190698] (16 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [188731] (3 PDB entries)

8. Domain d3elxa_: 3elx A: [175065]
   automated match to d1o1ua_
   complexed with edo

Details for d3elxa_

PDB Entry: 3elx, 1.6 Å

PDB Description: Crystal structure of apo Zebrafish Ileal Bile Acid-Binding Protein

PDB Compounds: (A:) Ileal bile acid-binding protein

SCOPe Domain Sequences for d3elxa_:

Sequence; same for both SEQRES and ATOM records:

>d3elxa_ b.60.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
gsafngkwetesqegyepfckligipddviakgrdfklvteivqngddftwtqyypnnhv
vtnkfivgkesdmetvggkkfkgivsmeggkltisfpkyqqtteisggklvetstasgaq
gtavlvrtskkvlv

Timeline for d3elxa_:

• d3elxa_ first appeared in SCOPe 2.01
  
• d3elxa_ appears in SCOPe 2.04
  
• d3elxa_ is called d3elxa1 in SCOPe 2.06
  
• d3elxa_ appears in the current release, SCOPe 2.08, called d3elxa1