SCOPe 2.08: Domain d3elhb1: 3elh B:2-130

Lineage for d3elhb1 (3elh B:2-130)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (18 species)
   not a true protein

7. Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries)

8. Domain d3elhb1: 3elh B:2-130 [175056]
   Other proteins in same PDB: d3elha2, d3elhb2, d3elhc2, d3elhd2, d3elhe2, d3elhf2
   automated match to d2b8pa1
   complexed with dud, mg

Details for d3elhb1

PDB Entry: 3elh, 2.4 Å

PDB Description: x-ray structure of acanthamoeba ployphaga mimivirus nucleoside diphosphate kinase complexed with dudp

PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3elhb1:

Sequence; same for both SEQRES and ATOM records:

>d3elhb1 d.58.6.1 (B:2-130) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
ncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdsedsav
deisiwfpe

Timeline for d3elhb1:

• d3elhb1 first appeared in SCOPe 2.01, called d3elhb_
  
• d3elhb1 appears in SCOPe 2.07