Lineage for d3elha_ (3elh A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1415050Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1415051Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1415295Protein automated matches [190032] (11 species)
    not a true protein
  7. 1415296Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries)
  8. 1415347Domain d3elha_: 3elh A: [175055]
    automated match to d2b8pa1
    complexed with dud, mg

Details for d3elha_

PDB Entry: 3elh (more details), 2.4 Å

PDB Description: X-ray structure of Acanthamoeba ployphaga mimivirus nucleoside diphosphate kinase complexed with dUDP
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3elha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3elha_ d.58.6.1 (A:) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
aglqrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsy
fndncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdsed
savdeisiwfpet

SCOPe Domain Coordinates for d3elha_:

Click to download the PDB-style file with coordinates for d3elha_.
(The format of our PDB-style files is described here.)

Timeline for d3elha_: