Class b: All beta proteins [48724] (180 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein Human immunodeficiency virus type 1 protease [50632] (9 species) |
Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [187932] (17 PDB entries) |
Domain d3ekyb_: 3eky B: [175040] automated match to d1kzka_ complexed with dr7, po4 |
PDB Entry: 3eky (more details), 1.8 Å
SCOPe Domain Sequences for d3ekyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ekyb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]} pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd qipieicghkaigtvlvgptpvniigrnlltqigctlnf
Timeline for d3ekyb_: