Lineage for d3ekyb_ (3eky B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2799131Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2799147Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2799148Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [187932] (17 PDB entries)
  8. 2799170Domain d3ekyb_: 3eky B: [175040]
    automated match to d1kzka_
    complexed with dr7, po4

Details for d3ekyb_

PDB Entry: 3eky (more details), 1.8 Å

PDB Description: crystal structure of wild-type hiv protease in complex with the inhibitor, atazanavir
PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d3ekyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ekyb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf

SCOPe Domain Coordinates for d3ekyb_:

Click to download the PDB-style file with coordinates for d3ekyb_.
(The format of our PDB-style files is described here.)

Timeline for d3ekyb_: