SCOPe 2.04: Domain d3ekxa_: 3ekx A:

Lineage for d3ekxa_ (3ekx A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (8 species)

7. Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [187932] (17 PDB entries)

8. Domain d3ekxa_: 3ekx A: [175037]
   automated match to d1kzka_
   complexed with 1un, act

Details for d3ekxa_

PDB Entry: 3ekx, 1.97 Å

PDB Description: crystal structure of the wild-type hiv-1 protease with the inhibitor, nelfinavir

PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3ekxa_:

Sequence; same for both SEQRES and ATOM records:

>d3ekxa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d3ekxa_:

• d3ekxa_ first appeared in SCOPe 2.01
  
• d3ekxa_ appears in SCOPe 2.03
  
• d3ekxa_ appears in SCOPe 2.05
  
• d3ekxa_ appears in the current release, SCOPe 2.08