Lineage for d3ekxa_ (3ekx A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2799131Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2799147Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2799148Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [187932] (17 PDB entries)
  8. 2799181Domain d3ekxa_: 3ekx A: [175037]
    automated match to d1kzka_
    complexed with 1un, act

Details for d3ekxa_

PDB Entry: 3ekx (more details), 1.97 Å

PDB Description: crystal structure of the wild-type hiv-1 protease with the inhibitor, nelfinavir
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3ekxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ekxa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf

SCOPe Domain Coordinates for d3ekxa_:

Click to download the PDB-style file with coordinates for d3ekxa_.
(The format of our PDB-style files is described here.)

Timeline for d3ekxa_: