![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
![]() | Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
![]() | Protein Human immunodeficiency virus type 1 protease [50632] (9 species) |
![]() | Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [187932] (17 PDB entries) |
![]() | Domain d3ekxa_: 3ekx A: [175037] automated match to d1kzka_ complexed with 1un, act |
PDB Entry: 3ekx (more details), 1.97 Å
SCOPe Domain Sequences for d3ekxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ekxa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]} pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd qipieicghkaigtvlvgptpvniigrnlltqigctlnf
Timeline for d3ekxa_: