SCOPe 2.05: Domain d3ekpc_: 3ekp C:

Lineage for d3ekpc_ (3ekp C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (8 species)

7. Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [187932] (17 PDB entries)

8. Domain d3ekpc_: 3ekp C: [175023]
   automated match to d1mt7a_
   complexed with 478, act, po4

Details for d3ekpc_

PDB Entry: 3ekp, 2.15 Å

PDB Description: crystal structure of the inhibitor amprenavir (apv) in complex with a multi-drug resistant hiv-1 protease variant (l10i/g48v/i54v/v64i/v82a)refer: flap+ in citation

PDB Compounds: (C:) Protease

SCOPe Domain Sequences for d3ekpc_:

Sequence; same for both SEQRES and ATOM records:

>d3ekpc_ b.50.1.1 (C:) Human immunodeficiency virus type 1 protease {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]}
pqitlwkrpivtiriggqlkealldtgaddtvleemnlpgkwkpkmivgiggfvkvrqyd
qipieicghkaigtvlvgptpaniigrnlltqigctlnf

Timeline for d3ekpc_:

• d3ekpc_ first appeared in SCOPe 2.01
  
• d3ekpc_ appears in SCOPe 2.04
  
• d3ekpc_ appears in SCOPe 2.06
  
• d3ekpc_ appears in the current release, SCOPe 2.08