Lineage for d3ekna_ (3ekn A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2543981Protein Insulin receptor [56162] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 2543982Species Human (Homo sapiens) [TaxId:9606] [56163] (18 PDB entries)
  8. 2543990Domain d3ekna_: 3ekn A: [175018]
    automated match to d1p14a_
    complexed with gs3

Details for d3ekna_

PDB Entry: 3ekn (more details), 2.2 Å

PDB Description: Insulin receptor kinase complexed with an inhibitor
PDB Compounds: (A:) Insulin receptor

SCOPe Domain Sequences for d3ekna_:

Sequence, based on SEQRES records: (download)

>d3ekna_ d.144.1.7 (A:) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
yvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslrerie
flneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrpp
ptlqemiqmaaeiadgmaylnakkfvhrnlaarncmvahdftvkigdfgmtrdiyetdyy
rkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvm
dggyldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhseenk

Sequence, based on observed residues (ATOM records): (download)

>d3ekna_ d.144.1.7 (A:) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
yvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslrerie
flneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrpp
ptlqemiqmaaeiadgmaylnakkfvhrnlaarncmvahdftvkigdfgmtrdiyetdyy
rkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdgg
yldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhseenk

SCOPe Domain Coordinates for d3ekna_:

Click to download the PDB-style file with coordinates for d3ekna_.
(The format of our PDB-style files is described here.)

Timeline for d3ekna_: