Lineage for d3ekka_ (3ekk A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2219815Protein Insulin receptor [56162] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 2219816Species Human (Homo sapiens) [TaxId:9606] [56163] (18 PDB entries)
  8. 2219823Domain d3ekka_: 3ekk A: [175017]
    automated match to d1p14a_
    complexed with gs2

Details for d3ekka_

PDB Entry: 3ekk (more details), 2.1 Å

PDB Description: Insulin receptor kinase complexed with an inhibitor
PDB Compounds: (A:) Insulin receptor

SCOPe Domain Sequences for d3ekka_:

Sequence, based on SEQRES records: (download)

>d3ekka_ d.144.1.7 (A:) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
pssvyvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslr
erieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennp
grppptlqemiqmaaeiadgmaylnakkfvhrnlaarncmvahdftvkigdfgmtrdiye
tdyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvl
kfvmdggyldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhs
een

Sequence, based on observed residues (ATOM records): (download)

>d3ekka_ d.144.1.7 (A:) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
pssvyvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslr
erieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennp
grppptlqemiqmaaeiadgmaylnakkfvhrnlaarncmvahdftvkigdfllpvrwma
peslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdggyldqpdncper
vtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhseen

SCOPe Domain Coordinates for d3ekka_:

Click to download the PDB-style file with coordinates for d3ekka_.
(The format of our PDB-style files is described here.)

Timeline for d3ekka_: