Lineage for d3ekfa_ (3ekf A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005023Protein Cytochrome P450 bm-3 [48268] (1 species)
  7. 2005024Species Bacillus megaterium [TaxId:1404] [48269] (76 PDB entries)
    Uniprot P14779
  8. 2005122Domain d3ekfa_: 3ekf A: [175015]
    automated match to d1jpza_
    complexed with hem

Details for d3ekfa_

PDB Entry: 3ekf (more details), 2.1 Å

PDB Description: Crystal structure of the A264Q heme domain of cytochrome P450 BM3
PDB Compounds: (A:) Cytochrome P450(BM-3)

SCOPe Domain Sequences for d3ekfa_:

Sequence, based on SEQRES records: (download)

>d3ekfa_ a.104.1.1 (A:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
kdpetgeplddeniryqiitfliqghettsgllsfalyflvknphvlqkaaeeaarvlvd
pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
fdfedhtnyeldiketltlkpegfvvkakskkiplg

Sequence, based on observed residues (ATOM records): (download)

>d3ekfa_ a.104.1.1 (A:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
ldeamnklqranqfqekvmndlvdkiiadrkasqsddllthmlngkdpetgeplddenir
yqiitfliqghettsgllsfalyflvknphvlqkaaeeaarvlvdpvpsykqvkqlkyvg
mvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrdktiwgddveefr
perfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdfedhtnyeldike
tltlkpegfvvkakskkiplg

SCOPe Domain Coordinates for d3ekfa_:

Click to download the PDB-style file with coordinates for d3ekfa_.
(The format of our PDB-style files is described here.)

Timeline for d3ekfa_: