SCOPe 2.06: Domain d3ekca_: 3ekc A:

Lineage for d3ekca_ (3ekc A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88602] (424 PDB entries)
   Uniprot P61769 21-119 ! Uniprot P01884

8. Domain d3ekca_: 3ekc A: [175012]
   automated match to d1a9bb_
   mutant

Details for d3ekca_

PDB Entry: 3ekc, 1.8 Å

PDB Description: structure of w60v beta-2 microglobulin mutant

PDB Compounds: (A:) Beta-2-microglobulin

SCOPe Domain Sequences for d3ekca_:

Sequence; same for both SEQRES and ATOM records:

>d3ekca_ b.1.1.2 (A:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
vsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm

Timeline for d3ekca_:

• d3ekca_ first appeared in SCOPe 2.01
  
• d3ekca_ appears in SCOPe 2.05
  
• d3ekca_ appears in SCOPe 2.07
  
• d3ekca_ appears in the current release, SCOPe 2.08