Lineage for d3ek6e_ (3ek6 E:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2155087Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2155088Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2155241Family c.73.1.0: automated matches [191466] (1 protein)
    not a true family
  6. 2155242Protein automated matches [190728] (15 species)
    not a true protein
  7. 2155355Species Xanthomonas campestris pv. campestris [TaxId:340] [188705] (2 PDB entries)
  8. 2155360Domain d3ek6e_: 3ek6 E: [175006]
    Other proteins in same PDB: d3ek6a2
    automated match to d2bnda1

Details for d3ek6e_

PDB Entry: 3ek6 (more details), 2.34 Å

PDB Description: Unique GTP-binding Pocket and Allostery of UMP Kinase from a Gram-Negative Phytopathogen Bacterium
PDB Compounds: (E:) uridylate kinase

SCOPe Domain Sequences for d3ek6e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ek6e_ c.73.1.0 (E:) automated matches {Xanthomonas campestris pv. campestris [TaxId: 340]}
elsyrrillklsgealmgdgdygidpkvinrlahevieaqqagaqvalvigggnifrgag
laasgmdrvtgdhmgmlatvinalamqdaleklgakvrvmsaikindvcedfirrrairh
lekgriaifaagtgnpffttdsgaalraieigadlllkatkvdgvydkdpkkhsdavryd
sltydevimqglevmdtaafalardsdlplrifgmsepgvllrilhgaqigtlvqgrs

SCOPe Domain Coordinates for d3ek6e_:

Click to download the PDB-style file with coordinates for d3ek6e_.
(The format of our PDB-style files is described here.)

Timeline for d3ek6e_: