Lineage for d3ek5a1 (3ek5 A:1-240)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905127Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2905128Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2905281Family c.73.1.0: automated matches [191466] (1 protein)
    not a true family
  6. 2905282Protein automated matches [190728] (15 species)
    not a true protein
  7. 2905477Species Xanthomonas campestris pv. campestris [TaxId:340] [188705] (2 PDB entries)
  8. 2905484Domain d3ek5a1: 3ek5 A:1-240 [174996]
    Other proteins in same PDB: d3ek5a2
    automated match to d2bnda1
    complexed with gtp

Details for d3ek5a1

PDB Entry: 3ek5 (more details), 2.56 Å

PDB Description: Unique GTP-binding Pocket and Allostery of UMP Kinase from a Gram-Negative Phytopathogen Bacterium
PDB Compounds: (A:) uridylate kinase

SCOPe Domain Sequences for d3ek5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ek5a1 c.73.1.0 (A:1-240) automated matches {Xanthomonas campestris pv. campestris [TaxId: 340]}
mselsyrrillklsgealmgdgdygidpkvinrlahevieaqqagaqvalvigggnifrg
aglaasgmdrvtgdhmgmlatvinalamqdaleklgakvrvmsaikindvcedfirrrai
rhlekgriaifaagtgnpffttdsgaalraieigadlllkatkvdgvydkdpkkhsdavr
ydsltydevimqglevmdtaafalardsdlplrifgmsepgvllrilhgaqigtlvqgrs

SCOPe Domain Coordinates for d3ek5a1:

Click to download the PDB-style file with coordinates for d3ek5a1.
(The format of our PDB-style files is described here.)

Timeline for d3ek5a1: