SCOPe 2.01: Domain d3ejmb_: 3ejm B:

Lineage for d3ejmb_ (3ejm B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (8 species)
   not a true protein

7. Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries)

8. Domain d3ejmb_: 3ejm B: [174987]
   automated match to d2b8pa1
   complexed with gdp, mg; mutant

Details for d3ejmb_

PDB Entry: 3ejm, 1.95 Å

PDB Description: Crystal structure of the mimivirus NDK +Kpn mutant complexed with GDP

PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3ejmb_:

Sequence; same for both SEQRES and ATOM records:

>d3ejmb_ d.58.6.1 (B:) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
lqrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfn
dncdfmvsgpiisivyegtdaiskirrlqgntnplasapgtirgdlandirenlihasds
edsavdeisiwfpe

Timeline for d3ejmb_:

• d3ejmb_ is new in SCOPe 2.01-stable
  
• d3ejmb_ appears in SCOPe 2.02
  
• d3ejmb_ appears in the current release, SCOPe 2.08, called d3ejmb1