Lineage for d3ejjb_ (3ejj B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 912412Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 912413Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 912488Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 912611Protein automated matches [190501] (2 species)
    not a true protein
  7. 912624Species Mouse (Mus musculus) [TaxId:10090] [187941] (4 PDB entries)
  8. 912628Domain d3ejjb_: 3ejj B: [174985]
    automated match to d1hmca_

Details for d3ejjb_

PDB Entry: 3ejj (more details), 2.4 Å

PDB Description: structure of m-csf bound to the first three domains of fms
PDB Compounds: (B:) Colony stimulating factor-1

SCOPe Domain Sequences for d3ejjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ejjb_ a.26.1.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sehcshmignghlkvlqqlidsqmetscqiafefvdqeqlddpvcylkkafflvqdiide
tmrfkdntpnanaterlqelsnnlnscftkdyeeqnkacvrtfhetplqllekiknffne
tknllekdwniftkncnnsfakcss

SCOPe Domain Coordinates for d3ejjb_:

Click to download the PDB-style file with coordinates for d3ejjb_.
(The format of our PDB-style files is described here.)

Timeline for d3ejjb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ejja_