![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
![]() | Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) ![]() |
![]() | Family d.80.1.1: 4-oxalocrotonate tautomerase-like [55332] (5 proteins) dimer of beta-alpha-beta subunits: may assemble further in hexamer (trimer of the dimers) |
![]() | Protein automated matches [190993] (1 species) not a true protein |
![]() | Species Pseudomonas pavonaceae [TaxId:47881] [188704] (3 PDB entries) |
![]() | Domain d3ej9a_: 3ej9 A: [174977] automated match to d1s0ya_ |
PDB Entry: 3ej9 (more details), 1.5 Å
SCOPe Domain Sequences for d3ej9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ej9a_ d.80.1.1 (A:) automated matches {Pseudomonas pavonaceae [TaxId: 47881]} pmiscdmrygrtdeqkralsagllrviseatgepreniffviregsginfvqhgehlpdy vp
Timeline for d3ej9a_: