Lineage for d3ej8d_ (3ej8 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2609056Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 2609057Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 2609058Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 2610000Protein automated matches [190421] (6 species)
    not a true protein
  7. 2610172Species Human (Homo sapiens) [TaxId:9606] [187302] (87 PDB entries)
  8. 2610320Domain d3ej8d_: 3ej8 D: [174976]
    automated match to d1jwja_
    complexed with h4b, hec, imd, zn; mutant

Details for d3ej8d_

PDB Entry: 3ej8 (more details), 2.55 Å

PDB Description: structure of double mutant of human inos oxygenase domain with bound immidazole
PDB Compounds: (D:) Nitric oxide synthase, inducible

SCOPe Domain Sequences for d3ej8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ej8d_ d.174.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellpq
aiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcig
riqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwna
qliryagyqmpdgsirgdpanveitqlcidlgwkpkygrfdvlplvlqangrdpelfeip
pdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrd
fcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaes
fmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwq
d

SCOPe Domain Coordinates for d3ej8d_:

Click to download the PDB-style file with coordinates for d3ej8d_.
(The format of our PDB-style files is described here.)

Timeline for d3ej8d_: