SCOPe 2.06: Domain d3ej8d_: 3ej8 D:

Lineage for d3ej8d_ (3ej8 D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)
   automatically mapped to Pfam PF02898

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)

6. Protein automated matches [190421] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187302] (35 PDB entries)

8. Domain d3ej8d_: 3ej8 D: [174976]
   automated match to d1jwja_
   complexed with h4b, hec, imd, zn; mutant

Details for d3ej8d_

PDB Entry: 3ej8, 2.55 Å

PDB Description: structure of double mutant of human inos oxygenase domain with bound immidazole

PDB Compounds: (D:) Nitric oxide synthase, inducible

SCOPe Domain Sequences for d3ej8d_:

Sequence; same for both SEQRES and ATOM records:

>d3ej8d_ d.174.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rhvriknwgsgmtfqdtlhhkakgiltcrsksclgsimtpksltrgprdkptppdellpq
aiefvnqyygsfkeakieehlarveavtkeiettgtyqltgdelifatkqawrnaprcig
riqwsnlqvfdarscstaremfehicrhvrystnngnirsaitvfpqrsdgkhdfrvwna
qliryagyqmpdgsirgdpanveitqlcidlgwkpkygrfdvlplvlqangrdpelfeip
pdlvlevamehpkyewfrelelkwyalpavanmllevgglefpgcpfngwymgteigvrd
fcdvqrynileevgrrmglethklaslwkdqavveiniavlhsfqkqnvtimdhhsaaes
fmkymqneyrsrggcpadwiwlvppmsgsitpvfhqemlnyvlspfyyyqveawkthvwq
d

Timeline for d3ej8d_:

• d3ej8d_ first appeared in SCOPe 2.01
  
• d3ej8d_ appears in SCOPe 2.05
  
• d3ej8d_ appears in SCOPe 2.07
  
• d3ej8d_ appears in the current release, SCOPe 2.08