Lineage for d3ej5x_ (3ej5 X:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2999974Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2999975Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2999976Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 3000147Protein automated matches [190420] (9 species)
    not a true protein
  7. 3000154Species Castor bean (Ricinus communis) [TaxId:3988] [188830] (15 PDB entries)
  8. 3000174Domain d3ej5x_: 3ej5 X: [174963]
    automated match to d1apga_
    complexed with ej5

Details for d3ej5x_

PDB Entry: 3ej5 (more details), 2.5 Å

PDB Description: complex of ricin a chain and pyrimidine-based inhibitor
PDB Compounds: (X:) ricin a chain

SCOPe Domain Sequences for d3ej5x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ej5x_ d.165.1.1 (X:) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]}
qypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsn
haelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnyd
rleqlagnlrenielgngpleeaisalyyystggtqlptlaisfiiciqmiseaarfqyi
egemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvyd
vsilipiialmvyrcap

SCOPe Domain Coordinates for d3ej5x_:

Click to download the PDB-style file with coordinates for d3ej5x_.
(The format of our PDB-style files is described here.)

Timeline for d3ej5x_: