Lineage for d3ej3k_ (3ej3 K:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2567390Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2567391Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2567392Family d.80.1.1: 4-oxalocrotonate tautomerase-like [55332] (5 proteins)
    dimer of beta-alpha-beta subunits: may assemble further in hexamer (trimer of the dimers)
  6. 2567609Protein automated matches [190993] (1 species)
    not a true protein
  7. 2567610Species Pseudomonas pavonaceae [TaxId:47881] [188704] (3 PDB entries)
  8. 2567627Domain d3ej3k_: 3ej3 K: [174961]
    automated match to d1s0ya_
    complexed with act, po4

Details for d3ej3k_

PDB Entry: 3ej3 (more details), 1.7 Å

PDB Description: Structural and mechanistic analysis of trans-3-chloroacrylic acid dehalogenase activity
PDB Compounds: (K:) Alpha-subunit of trans-3-chloroacrylic acid dehalogenase

SCOPe Domain Sequences for d3ej3k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ej3k_ d.80.1.1 (K:) automated matches {Pseudomonas pavonaceae [TaxId: 47881]}
pmiscdmrygrtdeqkralsagllrviseatgepreniffviregsginfvehgehlpdy
vp

SCOPe Domain Coordinates for d3ej3k_:

Click to download the PDB-style file with coordinates for d3ej3k_.
(The format of our PDB-style files is described here.)

Timeline for d3ej3k_: