Lineage for d3eiga_ (3eig A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2903431Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2903757Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 2903805Species Human (Homo sapiens) [TaxId:9606] [53607] (80 PDB entries)
  8. 2903821Domain d3eiga_: 3eig A: [174950]
    automated match to d1boza_
    complexed with cd, mtx, so4; mutant

Details for d3eiga_

PDB Entry: 3eig (more details), 1.7 Å

PDB Description: crystal structure of a methotrexate-resistant mutant of human dihydrofolate reductase
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3eiga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eiga_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Human (Homo sapiens) [TaxId: 9606]}
vgslncivavsqnmgigkngdlpwpplrnerryfermtttssvegkqnlvimgkktwfsi
peknrplkgrinlvlsrelkeppqgahflsrslddalklteqpelankvdmvwivggssv
ykeamnhpghlklfvtrimqdfesdtffpeidlekykllpeypgvlsdvqeekgikykfe
vyeknd

SCOPe Domain Coordinates for d3eiga_:

Click to download the PDB-style file with coordinates for d3eiga_.
(The format of our PDB-style files is described here.)

Timeline for d3eiga_: