SCOPe 2.05: Domain d3eicf_: 3eic F:

Lineage for d3eicf_ (3eic F:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (15 species)
   not a true protein

7. Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries)

8. Domain d3eicf_: 3eic F: [174949]
   automated match to d2b8pa1
   complexed with mg, udp

Details for d3eicf_

PDB Entry: 3eic, 2.3 Å

PDB Description: X-ray structure of Acanthamoeba ployphaga mimivirus nucleoside diphosphate kinase complexed with UDP

PDB Compounds: (F:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3eicf_:

Sequence; same for both SEQRES and ATOM records:

>d3eicf_ d.58.6.1 (F:) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
glqrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyf
ndncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdseds
avdeisiwfp

Timeline for d3eicf_:

• d3eicf_ first appeared in SCOPe 2.01
  
• d3eicf_ appears in SCOPe 2.04
  
• d3eicf_ is called d3eicf1 in SCOPe 2.06
  
• d3eicf_ appears in the current release, SCOPe 2.08, called d3eicf1