Lineage for d3eicd_ (3eic D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1651587Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1651588Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1651832Protein automated matches [190032] (13 species)
    not a true protein
  7. 1651833Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries)
  8. 1651867Domain d3eicd_: 3eic D: [174947]
    automated match to d2b8pa1
    complexed with mg, udp

Details for d3eicd_

PDB Entry: 3eic (more details), 2.3 Å

PDB Description: X-ray structure of Acanthamoeba ployphaga mimivirus nucleoside diphosphate kinase complexed with UDP
PDB Compounds: (D:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3eicd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eicd_ d.58.6.1 (D:) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
glqrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyf
ndncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdseds
avdeisiwfpet

SCOPe Domain Coordinates for d3eicd_:

Click to download the PDB-style file with coordinates for d3eicd_.
(The format of our PDB-style files is described here.)

Timeline for d3eicd_: