SCOPe 2.08: Domain d3eicc1: 3eic C:2-131

Lineage for d3eicc1 (3eic C:2-131)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (18 species)
   not a true protein

7. Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries)

8. Domain d3eicc1: 3eic C:2-131 [174946]
   Other proteins in same PDB: d3eica2, d3eicb2, d3eicc2, d3eicd2, d3eice2, d3eicf2
   automated match to d2b8pa1
   complexed with mg, udp

Details for d3eicc1

PDB Entry: 3eic, 2.3 Å

PDB Description: X-ray structure of Acanthamoeba ployphaga mimivirus nucleoside diphosphate kinase complexed with UDP

PDB Compounds: (C:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3eicc1:

Sequence; same for both SEQRES and ATOM records:

>d3eicc1 d.58.6.1 (C:2-131) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
ncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdsedsav
deisiwfpet

Timeline for d3eicc1:

• d3eicc1 first appeared in SCOPe 2.01, called d3eicc_
  
• d3eicc1 appears in SCOPe 2.07