Lineage for d3eheb_ (3ehe B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1830605Species Archaeoglobus fulgidus [TaxId:2234] [188631] (1 PDB entry)
  8. 1830607Domain d3eheb_: 3ehe B: [174938]
    automated match to d2b69a1
    complexed with nad

Details for d3eheb_

PDB Entry: 3ehe (more details), 1.87 Å

PDB Description: crystal structure of udp-glucose 4 epimerase (gale-1) from archaeoglobus fulgidus
PDB Compounds: (B:) UDP-glucose 4-epimerase (GalE-1)

SCOPe Domain Sequences for d3eheb_:

Sequence, based on SEQRES records: (download)

>d3eheb_ c.2.1.0 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
livvtggagfigshvvdklsesneivvidnlssgneefvneaarlvkadlaaddikdylk
gaeevwhiaanpdvrigaenpdeiyrnnvlatyrlleamrkagvsrivftststvygeak
viptpedypthpislygasklacealiesychtfdmqawiyrfanvigrrsthgviydfi
mklkrnpeeleilgngeqnksyiyisdcvdamlfglrgdervnifnigsedqikvkriae
ivceelglsprfrftggdrgwkgdvpvmllsieklkrlgwkprynseeavrmavrdlved
lde

Sequence, based on observed residues (ATOM records): (download)

>d3eheb_ c.2.1.0 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
livvtggagfigshvvdklsesneivvidnlssgneefvneaarlvkadlaaddikdylk
gaeevwhiaanpdvrgaenpdeiyrnnvlatyrlleamrkagvsrivftststvygeakv
iptpedypthpislygasklacealiesychtfdmqawiyrfanvigrrsthgviydfim
klkrnpeeleilgngeqnksyiyisdcvdamlfglrgdervnifnigsedqikvkriaei
vceelglsprfrftmllsieklkrlgwkprynseeavrmavrdlvedlde

SCOPe Domain Coordinates for d3eheb_:

Click to download the PDB-style file with coordinates for d3eheb_.
(The format of our PDB-style files is described here.)

Timeline for d3eheb_: