SCOPe 2.04: Domain d3egwc_: 3egw C:

Lineage for d3egwc_ (3egw C:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.3: Respiratory nitrate reductase 1 gamma chain [103501] (1 family)
   possible link between the two other superfamilies: this subunit corresponds to the gamma subunit of a functionally related Formate dehydrogenase N complex but is structurally closer to the Fumarate reductase subunit FrdC
   automatically mapped to Pfam PF02665

5. Family f.21.3.1: Respiratory nitrate reductase 1 gamma chain [103502] (2 proteins)

6. Protein automated matches [191115] (1 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189179] (4 PDB entries)

8. Domain d3egwc_: 3egw C: [174933]
   Other proteins in same PDB: d3egwa1, d3egwa2, d3egwb_
   automated match to d1q16c_
   complexed with 3ph, 6mo, aga, f3s, hem, md1, mgd, sf4; mutant

Details for d3egwc_

PDB Entry: 3egw, 1.9 Å

PDB Description: the crystal structure of the narghi mutant narh - c16a

PDB Compounds: (C:) Respiratory nitrate reductase 1 gamma chain

SCOPe Domain Sequences for d3egwc_:

Sequence; same for both SEQRES and ATOM records:

>d3egwc_ f.21.3.1 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil
gifvghffgmltphwmaaawlpievkqkmamfaggasgvlcliggvlllkrrlfsprvra
tttgadililsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgv
afifrlhlvlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh

Timeline for d3egwc_:

• d3egwc_ first appeared in SCOPe 2.01
  
• d3egwc_ appears in SCOPe 2.03
  
• d3egwc_ appears in SCOPe 2.05
  
• d3egwc_ appears in the current release, SCOPe 2.07