Lineage for d3egwb_ (3egw B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1413689Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 1413821Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 1413948Protein Respiratory nitrate reductase 1 beta chain [102955] (2 species)
  7. 1413953Species Escherichia coli [TaxId:562] [102956] (8 PDB entries)
    Uniprot P11349
  8. 1413954Domain d3egwb_: 3egw B: [174932]
    Other proteins in same PDB: d3egwa1, d3egwa2, d3egwc_
    automated match to d1q16b_
    complexed with 3ph, 6mo, aga, f3s, hem, md1, mgd, sf4; mutant

Details for d3egwb_

PDB Entry: 3egw (more details), 1.9 Å

PDB Description: the crystal structure of the narghi mutant narh - c16a
PDB Compounds: (B:) Respiratory nitrate reductase 1 beta chain

SCOPe Domain Sequences for d3egwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3egwb_ d.58.1.5 (B:) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]}
mkirsqvgmvlnldkaigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe
kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks
qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl
prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk
sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf
ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls
piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet
vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekngcgftf
gdgchgsdtkfnlfnsrridaidvtskte

SCOPe Domain Coordinates for d3egwb_:

Click to download the PDB-style file with coordinates for d3egwb_.
(The format of our PDB-style files is described here.)

Timeline for d3egwb_: