SCOPe 2.01: Domain d3egwb_: 3egw B:

Lineage for d3egwb_ (3egw B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families)

5. Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins)
   members of this "family" may be more closely related to other ferredoxins than to each other

6. Protein Respiratory nitrate reductase 1 beta chain [102955] (2 species)

7. Species Escherichia coli [TaxId:562] [102956] (8 PDB entries)
   Uniprot P11349

8. Domain d3egwb_: 3egw B: [174932]
   Other proteins in same PDB: d3egwc_
   automated match to d1q16b_
   complexed with 3ph, 6mo, aga, f3s, hem, md1, mgd, sf4; mutant

Details for d3egwb_

PDB Entry: 3egw, 1.9 Å

PDB Description: the crystal structure of the narghi mutant narh - c16a

PDB Compounds: (B:) Respiratory nitrate reductase 1 beta chain

SCOPe Domain Sequences for d3egwb_:

Sequence; same for both SEQRES and ATOM records:

>d3egwb_ d.58.1.5 (B:) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]}
mkirsqvgmvlnldkaigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe
kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks
qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl
prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk
sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf
ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls
piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet
vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekngcgftf
gdgchgsdtkfnlfnsrridaidvtskte

Timeline for d3egwb_:

• d3egwb_ is new in SCOPe 2.01-stable
  
• d3egwb_ appears in SCOPe 2.02
  
• d3egwb_ appears in the current release, SCOPe 2.08