SCOPe 2.08: Domain d3egmf1: 3egm F:1-166

Lineage for d3egmf1 (3egm F:1-166)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (34 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85963] [188967] (2 PDB entries)

8. Domain d3egmf1: 3egm F:1-166 [174931]
   Other proteins in same PDB: d3egma2, d3egmb2, d3egmc2, d3egmd2, d3egme2, d3egmf2
   automated match to d1krqa_
   complexed with fe, gol

Details for d3egmf1

PDB Entry: 3egm, 2.1 Å

PDB Description: structural basis of iron transport gating in helicobacter pylori ferritin

PDB Compounds: (F:) Ferritin

SCOPe Domain Sequences for d3egmf1:

Sequence; same for both SEQRES and ATOM records:

>d3egmf1 a.25.1.1 (F:1-166) automated matches {Helicobacter pylori [TaxId: 85963]}
mlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyehakkliif
lnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatfnfl
qwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk

Timeline for d3egmf1:

• d3egmf1 first appeared in SCOPe 2.01, called d3egmf_
  
• d3egmf1 appears in SCOPe 2.07