| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein automated matches [190041] (18 species) not a true protein |
| Species Helicobacter pylori [TaxId:85963] [188967] (1 PDB entry) |
| Domain d3egmd_: 3egm D: [174929] automated match to d1krqa_ complexed with fe, gol |
PDB Entry: 3egm (more details), 2.1 Å
SCOPe Domain Sequences for d3egmd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3egmd_ a.25.1.1 (D:) automated matches {Helicobacter pylori [TaxId: 85963]}
hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
kkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdh
atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
Timeline for d3egmd_: