SCOPe 2.04: Domain d3egmc_: 3egm C:

Lineage for d3egmc_ (3egm C:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (24 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85963] [188967] (1 PDB entry)

8. Domain d3egmc_: 3egm C: [174928]
   automated match to d1krqa_
   complexed with fe, gol

Details for d3egmc_

PDB Entry: 3egm, 2.1 Å

PDB Description: structural basis of iron transport gating in helicobacter pylori ferritin

PDB Compounds: (C:) Ferritin

SCOPe Domain Sequences for d3egmc_:

Sequence; same for both SEQRES and ATOM records:

>d3egmc_ a.25.1.1 (C:) automated matches {Helicobacter pylori [TaxId: 85963]}
hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
kkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdh
atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk

Timeline for d3egmc_:

• d3egmc_ first appeared in SCOPe 2.01
  
• d3egmc_ appears in SCOPe 2.03
  
• d3egmc_ appears in SCOPe 2.05
  
• d3egmc_ appears in the current release, SCOPe 2.08, called d3egmc1