SCOPe 2.01: Domain d3eg7d_: 3eg7 D:

Lineage for d3eg7d_ (3eg7 D:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (8 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [188612] (1 PDB entry)

8. Domain d3eg7d_: 3eg7 D: [174923]
   automated match to d1nsla_
   complexed with ipa, mg

Details for d3eg7d_

PDB Entry: 3eg7, 2.38 Å

PDB Description: spermidine n1-acetyltransferase from vibrio cholerae

PDB Compounds: (D:) Spermidine n1-acetyltransferase

SCOPe Domain Sequences for d3eg7d_:

Sequence; same for both SEQRES and ATOM records:

>d3eg7d_ d.108.1.0 (D:) automated matches {Vibrio cholerae [TaxId: 666]}
mnsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvv
edaqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiy
lhvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskyln

Timeline for d3eg7d_:

• d3eg7d_ is new in SCOPe 2.01-stable
  
• d3eg7d_ appears in SCOPe 2.02
  
• d3eg7d_ last appears in SCOPe 2.05