SCOPe 2.06: Domain d3eg6a_: 3eg6 A:

Lineage for d3eg6a_ (3eg6 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.4: WD40 repeat-like [50978] (4 families)
   also contains 8-bladed propellers

5. Family b.69.4.0: automated matches [191412] (1 protein)
   not a true family

6. Protein automated matches [190568] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187559] (46 PDB entries)

8. Domain d3eg6a_: 3eg6 A: [174919]
   automated match to d1vyhc1
   complexed with so4

Details for d3eg6a_

PDB Entry: 3eg6, 1.72 Å

PDB Description: structure of wdr5 bound to mll1 peptide

PDB Compounds: (A:) WD repeat-containing protein 5

SCOPe Domain Sequences for d3eg6a_:

Sequence; same for both SEQRES and ATOM records:

>d3eg6a_ b.69.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghklgi
sdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgsfd
esvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclktli
dddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsvtg
gkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktiklw
ksdc

Timeline for d3eg6a_:

• d3eg6a_ first appeared in SCOPe 2.01
  
• d3eg6a_ appears in SCOPe 2.05
  
• d3eg6a_ appears in SCOPe 2.07
  
• d3eg6a_ appears in the current release, SCOPe 2.08