Lineage for d3efpb_ (3efp B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1752846Fold a.184: TorD-like [89154] (1 superfamily)
    multihelical; bundle
  4. 1752847Superfamily a.184.1: TorD-like [89155] (1 family) (S)
  5. 1752848Family a.184.1.1: TorD-like [89156] (5 proteins)
    Pfam PF06192
  6. 1752864Protein automated matches [191026] (2 species)
    not a true protein
  7. 1752870Species Escherichia coli K-12 [TaxId:83333] [188829] (3 PDB entries)
  8. 1752872Domain d3efpb_: 3efp B: [174917]
    automated match to d1s9ua_
    complexed with cl, gol, na, trs

Details for d3efpb_

PDB Entry: 3efp (more details), 2.01 Å

PDB Description: Crystal structure of the Escherichia coli twin arginine leader peptide binding protein DmsD in a monomeric form
PDB Compounds: (B:) Twin-arginine leader-binding protein dmsD

SCOPe Domain Sequences for d3efpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3efpb_ a.184.1.1 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rwgsmthfsqqdnfsvaarvlgalfyyapesaeaaplvavltsdgwetqwplpeaslapl
vtafqtqceethaqawqrlfvgpwalpsppwgsvwldresvlfgdstlalrqwmrekgiq
femkqnepedhfgslllmaawlaengrqteceellawhlfpwstrfldvfiekaehpfyr
algelarltlaqwqsqllipvavkplfr

SCOPe Domain Coordinates for d3efpb_:

Click to download the PDB-style file with coordinates for d3efpb_.
(The format of our PDB-style files is described here.)

Timeline for d3efpb_: