SCOPe 2.08: Domain d3efpb1: 3efp B:1-204

Lineage for d3efpb1 (3efp B:1-204)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.184: TorD-like [89154] (1 superfamily)
   multihelical; bundle

4. Superfamily a.184.1: TorD-like [89155] (1 family)

5. Family a.184.1.1: TorD-like [89156] (5 proteins)
   Pfam PF06192

6. Protein automated matches [191026] (2 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [188829] (3 PDB entries)

8. Domain d3efpb1: 3efp B:1-204 [174917]
   Other proteins in same PDB: d3efpb2
   automated match to d1s9ua_
   complexed with cl, gol, na, trs

Details for d3efpb1

PDB Entry: 3efp, 2.01 Å

PDB Description: Crystal structure of the Escherichia coli twin arginine leader peptide binding protein DmsD in a monomeric form

PDB Compounds: (B:) Twin-arginine leader-binding protein dmsD

SCOPe Domain Sequences for d3efpb1:

Sequence; same for both SEQRES and ATOM records:

>d3efpb1 a.184.1.1 (B:1-204) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mthfsqqdnfsvaarvlgalfyyapesaeaaplvavltsdgwetqwplpeaslaplvtaf
qtqceethaqawqrlfvgpwalpsppwgsvwldresvlfgdstlalrqwmrekgiqfemk
qnepedhfgslllmaawlaengrqteceellawhlfpwstrfldvfiekaehpfyralge
larltlaqwqsqllipvavkplfr

Timeline for d3efpb1:

• d3efpb1 first appeared in SCOPe 2.01, called d3efpb_
  
• d3efpb1 appears in SCOPe 2.07