Lineage for d3ef4a_ (3ef4 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 940170Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 940171Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 941282Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 941283Protein automated matches [190824] (3 species)
    not a true protein
  7. 941298Species Hyphomicrobium denitrificans [TaxId:53399] [188702] (1 PDB entry)
  8. 941299Domain d3ef4a_: 3ef4 A: [174907]
    automated match to d1adwa_
    complexed with cu, po4

Details for d3ef4a_

PDB Entry: 3ef4 (more details), 1.18 Å

PDB Description: Crystal structure of native pseudoazurin from Hyphomicrobium denitrificans
PDB Compounds: (A:) Blue copper protein

SCOPe Domain Sequences for d3ef4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ef4a_ b.6.1.0 (A:) automated matches {Hyphomicrobium denitrificans [TaxId: 53399]}
aehivemrnkddagntmvfqpgfvkveagdtvkfvptdkshnaesvrevwpegvapvkgg
fskevvfnaekeglyvlkcaphygmgmvvlvqvgkpvnldqikeykatglakkrldgeia
kvvq

SCOPe Domain Coordinates for d3ef4a_:

Click to download the PDB-style file with coordinates for d3ef4a_.
(The format of our PDB-style files is described here.)

Timeline for d3ef4a_: