| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
| Protein automated matches [190824] (31 species) not a true protein |
| Species Hyphomicrobium denitrificans [TaxId:53399] [188702] (2 PDB entries) |
| Domain d3ef4a_: 3ef4 A: [174907] automated match to d1adwa_ complexed with cu, po4 |
PDB Entry: 3ef4 (more details), 1.18 Å
SCOPe Domain Sequences for d3ef4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ef4a_ b.6.1.0 (A:) automated matches {Hyphomicrobium denitrificans [TaxId: 53399]}
aehivemrnkddagntmvfqpgfvkveagdtvkfvptdkshnaesvrevwpegvapvkgg
fskevvfnaekeglyvlkcaphygmgmvvlvqvgkpvnldqikeykatglakkrldgeia
kvvq
Timeline for d3ef4a_: