Lineage for d3eelb_ (3eel B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1871769Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1871770Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1872191Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 1872192Protein automated matches [190777] (19 species)
    not a true protein
  7. 1872294Species Candida glabrata [TaxId:5478] [188965] (7 PDB entries)
  8. 1872296Domain d3eelb_: 3eel B: [174898]
    automated match to d1ai9a_
    complexed with 53t, ndp

Details for d3eelb_

PDB Entry: 3eel (more details), 1.95 Å

PDB Description: candida glabrata dihydrofolate reductase complexed with 2,4-diamino-5- [3-methyl-3-(3-methoxy-5-(3,5-dimethylphenyl)phenyl)prop-1-ynyl]-6- methylpyrimidine(ucp11153tm) and nadph
PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d3eelb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eelb_ c.71.1.0 (B:) automated matches {Candida glabrata [TaxId: 5478]}
kvpvvgivaallpemgigfqgnlpwrlakemkyfrevttltndnskqnvvimgrktwesi
pqkfrplpkrinvvvsrsfdgelrkvedgiyhsnslrncltalqsslanenkieriyiig
ggeiyrqsmdladhwlitkimplpettipqmdtflqkqeleqrfydnsdklvdflpssiq
legrltsqewngelvkglpvqekgyqfyftlytkklehhhhhhhh

SCOPe Domain Coordinates for d3eelb_:

Click to download the PDB-style file with coordinates for d3eelb_.
(The format of our PDB-style files is described here.)

Timeline for d3eelb_: