SCOPe 2.01: Domain d3eela_: 3eel A:

Lineage for d3eela_ (3eel A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (8 species)
   not a true protein

7. Species Candida glabrata [TaxId:5478] [188965] (7 PDB entries)

8. Domain d3eela_: 3eel A: [174897]
   automated match to d1ai9a_
   complexed with 53t, nap

Details for d3eela_

PDB Entry: 3eel, 1.95 Å

PDB Description: candida glabrata dihydrofolate reductase complexed with 2,4-diamino-5- [3-methyl-3-(3-methoxy-5-(3,5-dimethylphenyl)phenyl)prop-1-ynyl]-6- methylpyrimidine(ucp11153tm) and nadph

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3eela_:

Sequence; same for both SEQRES and ATOM records:

>d3eela_ c.71.1.0 (A:) automated matches {Candida glabrata [TaxId: 5478]}
kvpvvgivaallpemgigfqgnlpwrlakemkyfrevttltndnskqnvvimgrktwesi
pqkfrplpkrinvvvsrsfdgelrkvedgiyhsnslrncltalqsslanenkieriyiig
ggeiyrqsmdladhwlitkimplpettipqmdtflqkqeleqrfydnsdklvdflpssiq
legrltsqewngelvkglpvqekgyqfyftlytkklehhhhhhhh

Timeline for d3eela_:

• d3eela_ is new in SCOPe 2.01-stable
  
• d3eela_ appears in SCOPe 2.02
  
• d3eela_ appears in the current release, SCOPe 2.08, called d3eela1