| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
| Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
| Protein automated matches [190777] (28 species) not a true protein |
| Species Candida glabrata [TaxId:5478] [188965] (7 PDB entries) |
| Domain d3eela1: 3eel A:3-217 [174897] Other proteins in same PDB: d3eela2, d3eelb2 automated match to d1ai9a_ complexed with 53t, ndp |
PDB Entry: 3eel (more details), 1.95 Å
SCOPe Domain Sequences for d3eela1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eela1 c.71.1.0 (A:3-217) automated matches {Candida glabrata [TaxId: 5478]}
kvpvvgivaallpemgigfqgnlpwrlakemkyfrevttltndnskqnvvimgrktwesi
pqkfrplpkrinvvvsrsfdgelrkvedgiyhsnslrncltalqsslanenkieriyiig
ggeiyrqsmdladhwlitkimplpettipqmdtflqkqeleqrfydnsdklvdflpssiq
legrltsqewngelvkglpvqekgyqfyftlytkk
Timeline for d3eela1: