Lineage for d3eeia_ (3eei A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 996821Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 996837Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 996838Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 996896Protein 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase [82448] (3 species)
  7. 996913Species Neisseria meningitidis [TaxId:491] [188964] (1 PDB entry)
  8. 996914Domain d3eeia_: 3eei A: [174891]
    automated match to d1nc1b_
    complexed with mtm

Details for d3eeia_

PDB Entry: 3eei (more details), 1.78 Å

PDB Description: crystal structure of 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase from neisseria meningitidis in complex with methylthio- immucillin-a
PDB Compounds: (A:) 5-methylthioadenosine nucleosidase/S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d3eeia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eeia_ c.56.2.1 (A:) 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase {Neisseria meningitidis [TaxId: 491]}
lktvavigameqeiellremmenvkavsfgrfsayegelagkrmvlalsgigkvnaavat
awiirefaadcvintgsagglgkglkvgdvvigtetahhdvdvtafgyawgqvpqlparf
asdgilieaakraartfegaaveqglivsgdrfvhssegvaeirkhfpevkavemeaaai
aqtchqletpfviiravsdsadekadisfdeflktaaansakmvaeivksl

SCOPe Domain Coordinates for d3eeia_:

Click to download the PDB-style file with coordinates for d3eeia_.
(The format of our PDB-style files is described here.)

Timeline for d3eeia_: